Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E2f6 Rabbit Polyclonal Antibody (FITC)

E2f6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat E2f6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RRVYDITNVLDGIELVEKKSKNHIRWIGSDLNNFGAAPQQKKLQAELSDL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001094187

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-7001-3p miRNA Mimic
orb1874695-01 5 nmol

Mmu-miR-7001-3p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-7001-3p miRNA Mimic
orb1874695-02 10 nmol

Mmu-miR-7001-3p miRNA Mimic

Sign In for Pricing
View Details
NOMO3 (NODAL Modulator 3, Nomo) (MaxLight 650)
MBS6228980-01 0.1 mL

NOMO3 (NODAL Modulator 3, Nomo) (MaxLight 650)

Sign In for Pricing
View Details
NOMO3 (NODAL Modulator 3, Nomo) (MaxLight 650)
MBS6228980-02 5x 0.1 mL

NOMO3 (NODAL Modulator 3, Nomo) (MaxLight 650)

Sign In for Pricing
View Details
2-Amino-N-ethyl-N-methoxyacetamide hydrochloride
JBD33754-01 50 mg

2-Amino-N-ethyl-N-methoxyacetamide hydrochloride

Sign In for Pricing
View Details
2-Amino-N-ethyl-N-methoxyacetamide hydrochloride
JBD33754-02 0.5 g

2-Amino-N-ethyl-N-methoxyacetamide hydrochloride

Sign In for Pricing
View Details