Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E2f6 Rabbit Polyclonal Antibody (HRP)

E2f6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat E2f6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RRVYDITNVLDGIELVEKKSKNHIRWIGSDLNNFGAAPQQKKLQAELSDL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001094187

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC689065 ORF Vector (Rat) (pORF)
27449016 1.0 µg DNA

LOC689065 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
CD56 / NCAM (NCAM1/784), CF488A conjugate, 0.1mg/mL
BNC880784-100 1x 100 µL

CD56 / NCAM (NCAM1/784), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TULP2 Rabbit Polyclonal Antibody (Biotin)
orb446524 100 µL

TULP2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
PARP1 Rabbit mAb
F2623-100uL 100 µL

PARP1 Rabbit mAb

Sign In for Pricing
View Details
Gyg1 (NM_031043) Rat Untagged Clone
RN208175 10 µg

Gyg1 (NM_031043) Rat Untagged Clone

Sign In for Pricing
View Details
FXR1 (NM_001013438) Human Over-expression Lysate
LS008087-100ug 100 µg

FXR1 (NM_001013438) Human Over-expression Lysate

Sign In for Pricing
View Details