Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL26 Rabbit Polyclonal Antibody (Biotin)

RPL26 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L26, DBA11

UniProt

P61254

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEETIEKM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000978

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC βII (F-7)
sc-13149 200 µg/mL

PKC βII (F-7)

Sign In for Pricing
View Details
Renalase Recombinant Antibody, Cy7 Conjugated
bsm-62153R-Cy7 100 µL

Renalase Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
RANGAP1 (Ran GTPase-activating Protein 1, SD, Fug1, RANGAP) (PE)
MBS6434954-01 0.1 mL

RANGAP1 (Ran GTPase-activating Protein 1, SD, Fug1, RANGAP) (PE)

Sign In for Pricing
View Details
RANGAP1 (Ran GTPase-activating Protein 1, SD, Fug1, RANGAP) (PE)
MBS6434954-02 5x 0.1 mL

RANGAP1 (Ran GTPase-activating Protein 1, SD, Fug1, RANGAP) (PE)

Sign In for Pricing
View Details
Human Matrix Metalloproteinase 2 (MMP2) ELISA Kit
orb2668101-01 48 Tests

Human Matrix Metalloproteinase 2 (MMP2) ELISA Kit

Sign In for Pricing
View Details
Human Matrix Metalloproteinase 2 (MMP2) ELISA Kit
orb2668101-02 96 Tests

Human Matrix Metalloproteinase 2 (MMP2) ELISA Kit

Sign In for Pricing
View Details