Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NVL Rabbit Polyclonal Antibody (Biotin)

NVL Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NVL2

UniProt

O15381

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LSCEKSNPKKPITEIQDSKDSSLLESDMKRKGKLKNKGSKRKKEDLQEVD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_996671

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hendra virus/HeV Glycoprotein G Monoclonal Mouse Monoclonal Antibody
orb2956186-01 50 µg

Hendra virus/HeV Glycoprotein G Monoclonal Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Hendra virus/HeV Glycoprotein G Monoclonal Mouse Monoclonal Antibody
orb2956186-02 100 µg

Hendra virus/HeV Glycoprotein G Monoclonal Mouse Monoclonal Antibody

Sign In for Pricing
View Details
JPH1 Protein Lysate (Mouse) with C-HA Tag
25257034 100 µg

JPH1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
ELISA Kit for Membrane Spanning 4 Domains Subfamily A, Member 1 (CD20)
TRV-0064213-01 24 Tests

ELISA Kit for Membrane Spanning 4 Domains Subfamily A, Member 1 (CD20)

Sign In for Pricing
View Details
ELISA Kit for Membrane Spanning 4 Domains Subfamily A, Member 1 (CD20)
TRV-0064213-02 48 Tests

ELISA Kit for Membrane Spanning 4 Domains Subfamily A, Member 1 (CD20)

Sign In for Pricing
View Details
ELISA Kit for Membrane Spanning 4 Domains Subfamily A, Member 1 (CD20)
TRV-0064213-03 96 Tests

ELISA Kit for Membrane Spanning 4 Domains Subfamily A, Member 1 (CD20)

Sign In for Pricing
View Details