Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAG6 Rabbit Polyclonal Antibody (HRP)

BAG6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

G3, BAT3, BAG-6, D6S52E

UniProt

P46379

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFPNAQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

125kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_004630

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leucine-rich repeat neuronal protein 3 (LRRN3) Rat ELISA Kit
E6447 96 Tests

Leucine-rich repeat neuronal protein 3 (LRRN3) Rat ELISA Kit

Sign In for Pricing
View Details
Cyclin E1 (G1/S-specific Cyclin-E1, CCNE1, CCNE) (MaxLight 550)
MBS6375321-01 0.1 mL

Cyclin E1 (G1/S-specific Cyclin-E1, CCNE1, CCNE) (MaxLight 550)

Sign In for Pricing
View Details
Cyclin E1 (G1/S-specific Cyclin-E1, CCNE1, CCNE) (MaxLight 550)
MBS6375321-02 5x 0.1 mL

Cyclin E1 (G1/S-specific Cyclin-E1, CCNE1, CCNE) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant E Coli Tryptophanase
MBS140951-01 0.005 mg

Recombinant E Coli Tryptophanase

Sign In for Pricing
View Details
Recombinant E Coli Tryptophanase
MBS140951-02 0.02 mg

Recombinant E Coli Tryptophanase

Sign In for Pricing
View Details
Recombinant E Coli Tryptophanase
MBS140951-03 1 mg

Recombinant E Coli Tryptophanase

Sign In for Pricing
View Details