Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF5B Rabbit Polyclonal Antibody (HRP)

EIF5B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IF2

UniProt

O60841

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SEGSEGDEEDEKVSDEKDSGKTLDKKPSKEMSSDSEYDSDDDRTKEERAY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

139kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_056988

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CERKL Antibody
orb253831 100 µL

CERKL Antibody

Sign In for Pricing
View Details
FCGR3A, CT (FCGR3A, CD16A, FCG3, FCGR3, IGFR3, Low affinity immunoglobulin gamma Fc region receptor III-A, CD16a antigen, Fc-gamma RIII-alpha, FcR-10, IgG Fc receptor III-2, CD16a) (FITC) discontinued
035584-FITC 200 µL

FCGR3A, CT (FCGR3A, CD16A, FCG3, FCGR3, IGFR3, Low affinity immunoglobulin gamma Fc region receptor III-A, CD16a antigen, Fc-gamma RIII-alpha, FcR-10, IgG Fc receptor III-2, CD16a) (FITC) discontinued

Sign In for Pricing
View Details
Human CD45RO Mouse mAb, BF350 conjugated
orb2999861 100 µL

Human CD45RO Mouse mAb, BF350 conjugated

Sign In for Pricing
View Details
ZN606 Rabbit Polyclonal Antibody
JOT-AP05719-01 20 µL

ZN606 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZN606 Rabbit Polyclonal Antibody
JOT-AP05719-02 50 μL

ZN606 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZN606 Rabbit Polyclonal Antibody
JOT-AP05719-03 100 µL

ZN606 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details