Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Epha4 Rabbit Polyclonal Antibody (Biotin)

Epha4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

R, Se, rb, Sek, Tyr, Cek8, Hek8, Sek1, Tyro1, AI385584, 2900005C20Rik

UniProt

Q03137

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VISRRRSKYSKAKQEADEEKHLNQGVRTYVDPFTYEDPNQAVREFAKEID

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_031962

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IQ motif and SEC7 domain-containing protein 1, IQSEC1 ELISA Kit
MBS9336092-01 48 Well

Mouse IQ motif and SEC7 domain-containing protein 1, IQSEC1 ELISA Kit

Sign In for Pricing
View Details
Mouse IQ motif and SEC7 domain-containing protein 1, IQSEC1 ELISA Kit
MBS9336092-02 96 Well

Mouse IQ motif and SEC7 domain-containing protein 1, IQSEC1 ELISA Kit

Sign In for Pricing
View Details
Mouse IQ motif and SEC7 domain-containing protein 1, IQSEC1 ELISA Kit
MBS9336092-03 5x 96 Well

Mouse IQ motif and SEC7 domain-containing protein 1, IQSEC1 ELISA Kit

Sign In for Pricing
View Details
Mouse IQ motif and SEC7 domain-containing protein 1, IQSEC1 ELISA Kit
MBS9336092-04 10x 96 Well

Mouse IQ motif and SEC7 domain-containing protein 1, IQSEC1 ELISA Kit

Sign In for Pricing
View Details
Anti-PHYHD1 Antibody Picoband®, Cy3 Conjugate
A12964-1-Cy3 100 µg/Vial

Anti-PHYHD1 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Anti-p63/TP63 Antibody Picoband® (Dylight488 Conjugate)
PB9152-Dylight488 100 µg

Anti-p63/TP63 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details