Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS26A Rabbit Polyclonal Antibody (HRP)

VPS26A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HB58, PEP8A, VPS26, Hbeta58

UniProt

O75436

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004887

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR26 (NM_025160) Human Recombinant Protein
TP324575L 1 mg

WDR26 (NM_025160) Human Recombinant Protein

Sign In for Pricing
View Details
ITGB1BP1 (Integrin beta 1 Binding Protein 1, DKFZp686K08158, ICAP-1A, ICAP-1B, ICAP-1alpha, ICAP1, ICAP1A, ICAP1B) (MaxLight 490)
247757-ML490 100 µL

ITGB1BP1 (Integrin beta 1 Binding Protein 1, DKFZp686K08158, ICAP-1A, ICAP-1B, ICAP-1alpha, ICAP1, ICAP1A, ICAP1B) (MaxLight 490)

Sign In for Pricing
View Details
α-D-Mannopyranosyl azide
MM04372-01 10 mg

α-D-Mannopyranosyl azide

Sign In for Pricing
View Details
α-D-Mannopyranosyl azide
MM04372-02 25 mg

α-D-Mannopyranosyl azide

Sign In for Pricing
View Details
α-D-Mannopyranosyl azide
MM04372-03 50 mg

α-D-Mannopyranosyl azide

Sign In for Pricing
View Details
α-D-Mannopyranosyl azide
MM04372-04 100 mg

α-D-Mannopyranosyl azide

Sign In for Pricing
View Details