Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRA1 Rabbit Polyclonal Antibody (HRP)

SRA1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SRA, SRAP, STRAA1, pp7684

UniProt

Q9HD15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001030312

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zonula occludens protein 3/TJP3 Antibody Picoband®, Dylight550 Conjugate
PA1973-Dylight550 100 µg

Anti-Zonula occludens protein 3/TJP3 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
Sdz-15 Antibody
orb802222 2 mg

Sdz-15 Antibody

Sign In for Pricing
View Details
ATTO 565
E37F565-1-100 mg 100 mg

ATTO 565

Sign In for Pricing
View Details
Mouse Monoclonal Integrin beta 1/CD29 Antibody (8E3) [HRP]
NBP2-50139H 0.1 mL

Mouse Monoclonal Integrin beta 1/CD29 Antibody (8E3) [HRP]

Sign In for Pricing
View Details
Recombinant Human PSMD9
P4041-01 50 µg

Recombinant Human PSMD9

Sign In for Pricing
View Details
Recombinant Human PSMD9
P4041-02 200 µg

Recombinant Human PSMD9

Sign In for Pricing
View Details