Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNIP1 Rabbit Polyclonal Antibody (FITC)

TNIP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

VAN, NAF1, ABIN-1, nip40-1

UniProt

Q15025

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NSRLFHLPEYTWRLPCGGVRNPNQSSQVMDPPTARPTEPESPKNDREGPQ

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_006049

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macrophage Inflammatory Protein 3 alpha (CCL20) Human Gene Knockout Kit (CRISPR)
KN204691LP 1 Kit

Macrophage Inflammatory Protein 3 alpha (CCL20) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Eph receptor A6 (EPHA6) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B9]
TA809373AM 100 µL

Eph receptor A6 (EPHA6) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B9]

Sign In for Pricing
View Details
Scn10a Mouse Gene Knockout Kit (CRISPR)
KN515379 1 Kit

Scn10a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PDSS2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E9]
TA503973BM 100 µL

PDSS2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E9]

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/2754), CF568 conjugate, 0.1mg/mL
BNC682754-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/2754), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FYN pTyr530 Rabbit Polyclonal Antibody
AP20942PU-N 100 µg

FYN pTyr530 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details