Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNIP1 Rabbit Polyclonal Antibody (FITC)

TNIP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

VAN, NAF1, ABIN-1, nip40-1

UniProt

Q15025

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NSRLFHLPEYTWRLPCGGVRNPNQSSQVMDPPTARPTEPESPKNDREGPQ

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_006049

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HSF5 activation kit by CRISPRa
GA114845 1 Kit

Human HSF5 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Glycoprotein 2 (GP2) activation kit by CRISPRa
GA101880 1 Kit

Human Glycoprotein 2 (GP2) activation kit by CRISPRa

Sign In for Pricing
View Details
Phospho-Cytosolic Phospholipase A2 (S505) Recombinant Rabbit monoclonal Antibody
HA751176 100 µL

Phospho-Cytosolic Phospholipase A2 (S505) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
FastClick™ 6-FAM Azide
72711-AAT 1 mg

FastClick™ 6-FAM Azide

Sign In for Pricing
View Details
Human APOBEC3A_B activation kit by CRISPRa
GA119409 1 Kit

Human APOBEC3A_B activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Esophagus
CR560554 5 µg

Tissue Total RNA, Esophagus

Sign In for Pricing
View Details