Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNIP1 Rabbit Polyclonal Antibody (HRP)

TNIP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

VAN, NAF1, ABIN-1, nip40-1

UniProt

Q15025

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NSRLFHLPEYTWRLPCGGVRNPNQSSQVMDPPTARPTEPESPKNDREGPQ

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_006049

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DEFB129 Antibody
NBP2-68588-25ul 25 µL

Rabbit Polyclonal DEFB129 Antibody

Sign In for Pricing
View Details
CYS1 sgRNA CRISPR Lentivector set (Human)
K0557201 3x 1.0 µg

CYS1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
CD71 (TFRC) (NM_003234) Human Tagged ORF Clone Lentiviral Particle
RC200980L2V 200 µL

CD71 (TFRC) (NM_003234) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MGAT3 Antibody
DF15260-01 100 µL

MGAT3 Antibody

Sign In for Pricing
View Details
MGAT3 Antibody
DF15260-02 200 µL

MGAT3 Antibody

Sign In for Pricing
View Details
Klrk1 (NM_033078) Mouse Tagged ORF Clone Lentiviral Particle
MR202802L2V 200 µL

Klrk1 (NM_033078) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details