Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL7A Rabbit Polyclonal Antibody (Biotin)

RPL7A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L7A, TRUP, SURF3

UniProt

P62424

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KLVEAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELATKLG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000963

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pax-3 (CDHS, HUP 2, HUP2, MGC120381, MGC120382, MGC120383, MGC120384, MGC134778, Paired box 3, Paired box Gene 3, paired box homeotic Gene 3, Paired box Protein Pax 3, Paired box Protein Pax-3, Paired box Protein Pax3, paired Domain Gene 3, paired Domain Gene HuP2, PAX 3, Pax3, PAX3/FKHR Fusion Gene, PAX3, Waardenburg Syndrome 1, WS 1, WS1, WS3) discontinued
224884-01 50 µL

Pax-3 (CDHS, HUP 2, HUP2, MGC120381, MGC120382, MGC120383, MGC120384, MGC134778, Paired box 3, Paired box Gene 3, paired box homeotic Gene 3, Paired box Protein Pax 3, Paired box Protein Pax-3, Paired box Protein Pax3, paired Domain Gene 3, paired Domain Gene HuP2, PAX 3, Pax3, PAX3/FKHR Fusion Gene, PAX3, Waardenburg Syndrome 1, WS 1, WS1, WS3) discontinued

Sign In for Pricing
View Details
Pax-3 (CDHS, HUP 2, HUP2, MGC120381, MGC120382, MGC120383, MGC120384, MGC134778, Paired box 3, Paired box Gene 3, paired box homeotic Gene 3, Paired box Protein Pax 3, Paired box Protein Pax-3, Paired box Protein Pax3, paired Domain Gene 3, paired Domain Gene HuP2, PAX 3, Pax3, PAX3/FKHR Fusion Gene, PAX3, Waardenburg Syndrome 1, WS 1, WS1, WS3) discontinued
224884-02 100 µL

Pax-3 (CDHS, HUP 2, HUP2, MGC120381, MGC120382, MGC120383, MGC120384, MGC134778, Paired box 3, Paired box Gene 3, paired box homeotic Gene 3, Paired box Protein Pax 3, Paired box Protein Pax-3, Paired box Protein Pax3, paired Domain Gene 3, paired Domain Gene HuP2, PAX 3, Pax3, PAX3/FKHR Fusion Gene, PAX3, Waardenburg Syndrome 1, WS 1, WS1, WS3) discontinued

Sign In for Pricing
View Details
Dehydrodicatechin A
T124950-01 1 mg

Dehydrodicatechin A

Sign In for Pricing
View Details
Dehydrodicatechin A
T124950-02 5 mg

Dehydrodicatechin A

Sign In for Pricing
View Details
Complement C3, C3c (HRP)
C7850-14S8 1 mL

Complement C3, C3c (HRP)

Sign In for Pricing
View Details
CHM Rabbit mAb
RDSA66245 100 µL

CHM Rabbit mAb

Sign In for Pricing
View Details