Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rela Rabbit Polyclonal Antibody (Biotin)

Rela Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NFkB, nos2

UniProt

Q7TQN4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Rela

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_954888

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASXL1 (D1B6V) Rabbit Monoclonal Antibody
CST 52519T 20 µL

ASXL1 (D1B6V) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Luteinizing Hormone-Releasing Hormone,LHRH ELISA Kit
CN-02615M1 96T

Mouse Luteinizing Hormone-Releasing Hormone,LHRH ELISA Kit

Sign In for Pricing
View Details
TFG, ID (TFG, Protein TFG, TRK-fused gene protein) (MaxLight 650) discontinued
042769-ML650 100 µL

TFG, ID (TFG, Protein TFG, TRK-fused gene protein) (MaxLight 650) discontinued

Sign In for Pricing
View Details
CLTA, Recombinant, Human, aa1-218, His-Tag (Clathrin Light Chain A, Lca)
045416-01 100 µg

CLTA, Recombinant, Human, aa1-218, His-Tag (Clathrin Light Chain A, Lca)

Sign In for Pricing
View Details
CLTA, Recombinant, Human, aa1-218, His-Tag (Clathrin Light Chain A, Lca)
045416-02 500 µg

CLTA, Recombinant, Human, aa1-218, His-Tag (Clathrin Light Chain A, Lca)

Sign In for Pricing
View Details
Mouse Monoclonal TIMP-4 Antibody (MM0037-9F3) [Alexa Fluor 532]
NB110-61003AF532 0.1 mL

Mouse Monoclonal TIMP-4 Antibody (MM0037-9F3) [Alexa Fluor 532]

Sign In for Pricing
View Details