Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mapre1 Rabbit Polyclonal Antibody (Biotin)

Mapre1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BIM, Eb1, BIM1p, AI462499, AI504412, AW260097, D2Ertd459, D2Ertd459e, 5530600P05Rik

UniProt

Q61166

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_031922

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CLDN18.2 Antibody (hu7V3)
RHF19801 100 μg

Anti-Human CLDN18.2 Antibody (hu7V3)

Sign In for Pricing
View Details
Mouse Mitochondrial Glutathione Transporter SLC25A39 (SLC25A39) Protein
abx658967-01 10 µg

Mouse Mitochondrial Glutathione Transporter SLC25A39 (SLC25A39) Protein

Sign In for Pricing
View Details
Mouse Mitochondrial Glutathione Transporter SLC25A39 (SLC25A39) Protein
abx658967-02 50 µg

Mouse Mitochondrial Glutathione Transporter SLC25A39 (SLC25A39) Protein

Sign In for Pricing
View Details
Mouse Mitochondrial Glutathione Transporter SLC25A39 (SLC25A39) Protein
abx658967-03 100 µg

Mouse Mitochondrial Glutathione Transporter SLC25A39 (SLC25A39) Protein

Sign In for Pricing
View Details
Mouse Mitochondrial Glutathione Transporter SLC25A39 (SLC25A39) Protein
abx658967-04 200 µg

Mouse Mitochondrial Glutathione Transporter SLC25A39 (SLC25A39) Protein

Sign In for Pricing
View Details
Mouse Mitochondrial Glutathione Transporter SLC25A39 (SLC25A39) Protein
abx658967-05 500 µg

Mouse Mitochondrial Glutathione Transporter SLC25A39 (SLC25A39) Protein

Sign In for Pricing
View Details