Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mapre1 Rabbit Polyclonal Antibody (HRP)

Mapre1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BIM, Eb1, BIM1p, AI462499, AI504412, AW260097, D2Ertd459, D2Ertd459e, 5530600P05Rik

UniProt

Q61166

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_031922

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium Smegmatis rmlB Protein (aa 1-331)
VAng-Yyj4787-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Smegmatis rmlB Protein (aa 1-331)

Sign In for Pricing
View Details
RIP3, ID (Receptor-interacting Serine/Threonine-protein Kinase 3, RIP-like Protein Kinase 3, Receptor-interacting Protein 3, RIP-3, RIPK3)
MBS630410-01 0.2 mL

RIP3, ID (Receptor-interacting Serine/Threonine-protein Kinase 3, RIP-like Protein Kinase 3, Receptor-interacting Protein 3, RIP-3, RIPK3)

Sign In for Pricing
View Details
RIP3, ID (Receptor-interacting Serine/Threonine-protein Kinase 3, RIP-like Protein Kinase 3, Receptor-interacting Protein 3, RIP-3, RIPK3)
MBS630410-02 5x 0.2 mL

RIP3, ID (Receptor-interacting Serine/Threonine-protein Kinase 3, RIP-like Protein Kinase 3, Receptor-interacting Protein 3, RIP-3, RIPK3)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O45:K1 (strain S88/ExPEC) purH Polyclonal Antibody
MBS7177109 Inquire

Rabbit anti-Escherichia coli O45:K1 (strain S88/ExPEC) purH Polyclonal Antibody

Sign In for Pricing
View Details
Tryptophanyl tRNA synthetase (WARS) (NM_004184) Human Over-expression Lysate
LY401346 100 µg

Tryptophanyl tRNA synthetase (WARS) (NM_004184) Human Over-expression Lysate

Sign In for Pricing
View Details
N-Acetyl-L-methionine
orb1299258-01 100 mg

N-Acetyl-L-methionine

Sign In for Pricing
View Details