Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TGF-beta receptor type-2 (TGFBR2), partial

Product Specifications

Product Name Alternative

(TGFR-2) (TGF-beta type II receptor) (Transforming growth factor-beta receptor type II) (TGF-beta receptor type II) (TbetaR-II)

Abbreviation

Recombinant Human TGFBR2 protein, partial

Gene Name

TGFBR2

UniProt

P37173

Expression Region

23-166aa

Organism

Homo sapiens (Human)

Target Sequence

TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQ

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Transmembrane serine/threonine kinase forming with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and thus regulates a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways. ; [Isoform 1]: Has transforming growth factor beta-activated receptor activity. ; [Isoform 2]: Has transforming growth factor beta-activated receptor activity. ; [Isoform 3]: Binds TGFB1, TGFB2 and TGFB3 in the picomolar affinity range without the participation of additional receptors. Blocks activation of SMAD2 and SMAD3 by TGFB1.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

23.8 kDa

References & Citations

"A Novel Splice Variant of Human TGF-beta Type II Receptor Encodes a Soluble Protein and Its Fc-Tagged Version Prevents Liver Fibrosis in vivo." Bertolio M.S., La Colla A., Carrea A., Romo A., Canziani G., Echarte S.M., Campisano S., Barletta G.P., Monzon A.M., Rodriguez T.M., Chisari A.N., Dewey R.A. Front. Cell Dev. Biol. 9:690397-690397 (2021)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

AKT2 Antibody
MBS7128357-01 0.05 mL

AKT2 Antibody

Ask
View Details
AKT2 Antibody
MBS7128357-02 0.1 mL

AKT2 Antibody

Ask
View Details
AKT2 Antibody
MBS7128357-03 5x 0.1 mL

AKT2 Antibody

Ask
View Details
Adenosine deaminase Polyclonal Antibody, APC Conjugated
bs-6654R-APC 100 µL

Adenosine deaminase Polyclonal Antibody, APC Conjugated

Ask
View Details
Mouse Parkinson Disease 2/parkin Park2 ELISA Kit
BG-MUS11884 1 Each

Mouse Parkinson Disease 2/parkin Park2 ELISA Kit

Ask
View Details
Anti-DBF4 Antibody (R2R17)
RHN74701 100 μg

Anti-DBF4 Antibody (R2R17)

Ask
View Details