Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL2L12 Rabbit Polyclonal Antibody (HRP)

BCL2L12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC120313, MGC120314, MGC120315

UniProt

Q9HB09

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_619580

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEPT1, NT (SEPT1, DIFF6, PNUTL3, Septin-1, LARP, Peanut-like protein 3, Serologically defined breast cancer antigen NY-BR-24) (MaxLight 750)
MBS6346139-01 0.1 mL

SEPT1, NT (SEPT1, DIFF6, PNUTL3, Septin-1, LARP, Peanut-like protein 3, Serologically defined breast cancer antigen NY-BR-24) (MaxLight 750)

Sign In for Pricing
View Details
SEPT1, NT (SEPT1, DIFF6, PNUTL3, Septin-1, LARP, Peanut-like protein 3, Serologically defined breast cancer antigen NY-BR-24) (MaxLight 750)
MBS6346139-02 5x 0.1 mL

SEPT1, NT (SEPT1, DIFF6, PNUTL3, Septin-1, LARP, Peanut-like protein 3, Serologically defined breast cancer antigen NY-BR-24) (MaxLight 750)

Sign In for Pricing
View Details
Bovine phosphatidylinositol 4,5 bisphosphate phosphodiesterase β 1 (PLCB1) ELISA kit
GTR10373525 96 Well

Bovine phosphatidylinositol 4,5 bisphosphate phosphodiesterase β 1 (PLCB1) ELISA kit

Sign In for Pricing
View Details
C9orf24 Antibody - N-terminal region : HRP (ARP67034_P050-HRP)
ARP67034_P050-HRP 100 µL

C9orf24 Antibody - N-terminal region : HRP (ARP67034_P050-HRP)

Sign In for Pricing
View Details
CYP11A1 Polyclonal Antibody, Cy5 Conjugated
bs-10099R-Cy5 100 µL

CYP11A1 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
INF55
HY-W107077-01 100 mg

INF55

Sign In for Pricing
View Details