Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPVL Rabbit Polyclonal Antibody (Biotin)

CPVL Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HVLP

UniProt

Q9H3G5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CPVL

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MGMDWKGSQEYKKAEKKVWKIFKSDSEVAGYIRQAGDFHQVIIRGGGHIL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

XP_005249843

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNA-binding protein 41 (RBM41) Human ELISA Kit
G8316 96 Tests

RNA-binding protein 41 (RBM41) Human ELISA Kit

Sign In for Pricing
View Details
NR4A1 (S351) (Nuclear Receptor Subfamily 4 Group A Member 1, Orphan Nuclear Receptor TR3, Orphan Nuclear Receptor HMR, Early Response Protein NAK1, Testicular Receptor 3, ST-59, Nur77, GFRP1, HMR, NAK1) (Azide free) (HRP)
MBS6489299-01 0.2 mL

NR4A1 (S351) (Nuclear Receptor Subfamily 4 Group A Member 1, Orphan Nuclear Receptor TR3, Orphan Nuclear Receptor HMR, Early Response Protein NAK1, Testicular Receptor 3, ST-59, Nur77, GFRP1, HMR, NAK1) (Azide free) (HRP)

Sign In for Pricing
View Details
NR4A1 (S351) (Nuclear Receptor Subfamily 4 Group A Member 1, Orphan Nuclear Receptor TR3, Orphan Nuclear Receptor HMR, Early Response Protein NAK1, Testicular Receptor 3, ST-59, Nur77, GFRP1, HMR, NAK1) (Azide free) (HRP)
MBS6489299-02 5x 0.2 mL

NR4A1 (S351) (Nuclear Receptor Subfamily 4 Group A Member 1, Orphan Nuclear Receptor TR3, Orphan Nuclear Receptor HMR, Early Response Protein NAK1, Testicular Receptor 3, ST-59, Nur77, GFRP1, HMR, NAK1) (Azide free) (HRP)

Sign In for Pricing
View Details
Coch 3'UTR GFP Stable Cell Line
TU252592 1.0 mL

Coch 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ULP2 Antibody
orb852367 2 mg

ULP2 Antibody

Sign In for Pricing
View Details
GRK6 (G Protein-coupled Receptor Kinase 6, FLJ32135, GPRK6) (APC)
207677-APC 100 µL

GRK6 (G Protein-coupled Receptor Kinase 6, FLJ32135, GPRK6) (APC)

Sign In for Pricing
View Details