Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADGRE2 Rabbit Polyclonal Antibody (Biotin)

ADGRE2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

VBU, CD97, EMR2, CD312

UniProt

Q9UHX3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

89kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_690883

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ribosomal Protein L34 Rabbit Polyclonal Antibody
APRab17159-01 20 µL

Ribosomal Protein L34 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ribosomal Protein L34 Rabbit Polyclonal Antibody
APRab17159-02 50 µL

Ribosomal Protein L34 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ribosomal Protein L34 Rabbit Polyclonal Antibody
APRab17159-03 100 µL

Ribosomal Protein L34 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ribosomal Protein L34 Rabbit Polyclonal Antibody
APRab17159-04 200 µL

Ribosomal Protein L34 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SHMT2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV792794 1.0 µg DNA

SHMT2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
NIT1 (Nitrilase Homolog 1, MGC57670) (MaxLight 650)
130384-ML650 100 µL

NIT1 (Nitrilase Homolog 1, MGC57670) (MaxLight 650)

Sign In for Pricing
View Details