Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADGRE2 Rabbit Polyclonal Antibody (HRP)

ADGRE2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

VBU, CD97, EMR2, CD312

UniProt

Q9UHX3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

89kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_690883

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synaptotagmin VII siRNA (h)
sc-41320 10 µM

Synaptotagmin VII siRNA (h)

Sign In for Pricing
View Details
KRTAP11-1 HDR Plasmid (h)
sc-415478-HDR 20 µg

KRTAP11-1 HDR Plasmid (h)

Sign In for Pricing
View Details
USP13 polyclonal antibody
BS91411 50ul

USP13 polyclonal antibody

Sign In for Pricing
View Details
IFNA5 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-15520R-APC-Cy5.5 100 µL

IFNA5 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Anti-ZBT10 Rabbit pAb
GB115220-50 50 μL

Anti-ZBT10 Rabbit pAb

Sign In for Pricing
View Details
Human Proteasome Subunit Alpha Type 5 (PSMa5) ELISA Kit
EKN47997 96 Tests

Human Proteasome Subunit Alpha Type 5 (PSMa5) ELISA Kit

Sign In for Pricing
View Details