Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IMMT Rabbit Polyclonal Antibody (FITC)

IMMT Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HMP, P87, P89, PIG4, Mic60, PIG52, MINOS2, P87/89, MICOS60

UniProt

Q16891

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human IMMT

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KKSIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIIS

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_005264170

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal p53 Antibody (TRP/816) [Alexa Fluor 488]
NBP2-59628AF488 100 µL

Mouse Monoclonal p53 Antibody (TRP/816) [Alexa Fluor 488]

Sign In for Pricing
View Details
VASP CRISPR/Cas9 KO Plasmid (m2)
sc-423654-KO-2 20 µg

VASP CRISPR/Cas9 KO Plasmid (m2)

Sign In for Pricing
View Details
Med7 (NM_001104556) Mouse Tagged ORF Clone Lentiviral Particle
MR216388L4V 200 µL

Med7 (NM_001104556) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MKRN2, NT (MKRN2, RNF62, Probable E3 ubiquitin-protein ligase makorin-2, RING finger protein 62) (FITC)
MBS6321012-01 0.2 mL

MKRN2, NT (MKRN2, RNF62, Probable E3 ubiquitin-protein ligase makorin-2, RING finger protein 62) (FITC)

Sign In for Pricing
View Details
MKRN2, NT (MKRN2, RNF62, Probable E3 ubiquitin-protein ligase makorin-2, RING finger protein 62) (FITC)
MBS6321012-02 5x 0.2 mL

MKRN2, NT (MKRN2, RNF62, Probable E3 ubiquitin-protein ligase makorin-2, RING finger protein 62) (FITC)

Sign In for Pricing
View Details
Recombinant Anti-Histamine H3 Receptor Rabbit mAb
CMA6210-01 30 µL

Recombinant Anti-Histamine H3 Receptor Rabbit mAb

Sign In for Pricing
View Details