Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pdgfc Rabbit Polyclonal Antibody (Biotin)

Pdgfc Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PDGF-, SCDGF, PDGF-C, VEGF-E, AI647969, 1110064L01Rik

UniProt

Q8CI19

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Pdgfc

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVV

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_064355

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGLYRP3 siRNA (Mouse)
orb1835707-01 15 nmol

PGLYRP3 siRNA (Mouse)

Sign In for Pricing
View Details
PGLYRP3 siRNA (Mouse)
orb1835707-02 30 nmol

PGLYRP3 siRNA (Mouse)

Sign In for Pricing
View Details
Rabbit High Mobility Group Protein 1 (HMG1) ELISA Kit
MBS9356961-01 48 Well

Rabbit High Mobility Group Protein 1 (HMG1) ELISA Kit

Sign In for Pricing
View Details
Rabbit High Mobility Group Protein 1 (HMG1) ELISA Kit
MBS9356961-02 96 Well

Rabbit High Mobility Group Protein 1 (HMG1) ELISA Kit

Sign In for Pricing
View Details
Rabbit High Mobility Group Protein 1 (HMG1) ELISA Kit
MBS9356961-03 5x 96 Well

Rabbit High Mobility Group Protein 1 (HMG1) ELISA Kit

Sign In for Pricing
View Details
Rabbit High Mobility Group Protein 1 (HMG1) ELISA Kit
MBS9356961-04 10x 96 Well

Rabbit High Mobility Group Protein 1 (HMG1) ELISA Kit

Sign In for Pricing
View Details