Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCK1 Rabbit Polyclonal Antibody (HRP)

UCK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

URK1

UniProt

Q9HA47

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QRPFLIGVSGGTASGKSTVCEKIMELLGQNEVEQRQRKVVILSQDRFYKV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_113620

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human PNMT Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot)
MBS8424499-01 0.12 mL

Rabbit Anti Human PNMT Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot)

Sign In for Pricing
View Details
Rabbit Anti Human PNMT Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot)
MBS8424499-02 0.2 mL

Rabbit Anti Human PNMT Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot)

Sign In for Pricing
View Details
Rabbit Anti Human PNMT Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot)
MBS8424499-03 5x 0.2 mL

Rabbit Anti Human PNMT Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot)

Sign In for Pricing
View Details
MYPN (NM_032578) Human Tagged ORF Clone Lentiviral Particle
RC213189L4V 200 µL

MYPN (NM_032578) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
2-[2-(4’-Chloro-biphenyl-4-yl)-2-oxo-ethyl]acrylic Acid
TRC-C365055-250MG 250 mg

2-[2-(4’-Chloro-biphenyl-4-yl)-2-oxo-ethyl]acrylic Acid

Sign In for Pricing
View Details
GENLISA™ Cystathionine (CTH) ELISA
KLR3700 1x 96 Well

GENLISA™ Cystathionine (CTH) ELISA

Sign In for Pricing
View Details