Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPN3 Rabbit Polyclonal Antibody (Biotin)

PTPN3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PTPH1, PTP-H1

UniProt

E9PGU7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ASAGVAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

86kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001138841

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Polyclonal Antibody to Secretoglobin Family 2A, Member 2 (SCGB2A2)
MBS2096208-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Secretoglobin Family 2A, Member 2 (SCGB2A2)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Secretoglobin Family 2A, Member 2 (SCGB2A2)
MBS2096208-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Secretoglobin Family 2A, Member 2 (SCGB2A2)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Secretoglobin Family 2A, Member 2 (SCGB2A2)
MBS2096208-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Secretoglobin Family 2A, Member 2 (SCGB2A2)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Secretoglobin Family 2A, Member 2 (SCGB2A2)
MBS2096208-04 1 mL

Biotin-Linked Polyclonal Antibody to Secretoglobin Family 2A, Member 2 (SCGB2A2)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Secretoglobin Family 2A, Member 2 (SCGB2A2)
MBS2096208-05 5 mL

Biotin-Linked Polyclonal Antibody to Secretoglobin Family 2A, Member 2 (SCGB2A2)

Sign In for Pricing
View Details
CTRL, ID (CTRL, CTRL1, Chymotrypsin-like protease CTRL-1) (MaxLight 550) discontinued
034344-ML550 100 µL

CTRL, ID (CTRL, CTRL1, Chymotrypsin-like protease CTRL-1) (MaxLight 550) discontinued

Sign In for Pricing
View Details