Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK11A Rabbit Polyclonal Antibody (HRP)

CDK11A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CDC2L2, CDC2L3, p58GTA, PITSLRE, CDK11-p46, CDK11-p58, CDK11-p110

UniProt

Q9UQ88

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_277071

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Sphingosine Kinase 1 ELISA Kit
MBS075778-01 48 Well

Bovine Sphingosine Kinase 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Sphingosine Kinase 1 ELISA Kit
MBS075778-02 96 Well

Bovine Sphingosine Kinase 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Sphingosine Kinase 1 ELISA Kit
MBS075778-03 5x 96 Well

Bovine Sphingosine Kinase 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Sphingosine Kinase 1 ELISA Kit
MBS075778-04 10x 96 Well

Bovine Sphingosine Kinase 1 ELISA Kit

Sign In for Pricing
View Details
NLGN4X (Neuroligin-4, X-linked) BioAssayTM ELISA Kit (Human) discontinued
357627-01 48 Tests

NLGN4X (Neuroligin-4, X-linked) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
NLGN4X (Neuroligin-4, X-linked) BioAssayTM ELISA Kit (Human) discontinued
357627-02 96 Tests

NLGN4X (Neuroligin-4, X-linked) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details