Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCT3 Rabbit Polyclonal Antibody (Biotin)

CCT3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CCTG, PIG48, TRIC5, CCT-gamma, TCP-1-gamma

UniProt

P49368

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQGGAP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005989

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DSC2 Antibody
A19881-50UL 50 μL

DSC2 Antibody

Sign In for Pricing
View Details
Defb46 sgRNA CRISPR Lentivector set (Mouse)
K3340301 3x 1.0 µg

Defb46 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
SteroiCanineenic acute regulatory protein mitochondrial (STAR) Horse ELISA Kit
H3269 96 Tests

SteroiCanineenic acute regulatory protein mitochondrial (STAR) Horse ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-human cartilage associated protein polyclonal Antibody
MBS711187-01 0.1 mL

Rabbit anti-human cartilage associated protein polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human cartilage associated protein polyclonal Antibody
MBS711187-02 5x 0.1 mL

Rabbit anti-human cartilage associated protein polyclonal Antibody

Sign In for Pricing
View Details
TRIM9 Adenovirus (Rat)
47850056 1.0 mL

TRIM9 Adenovirus (Rat)

Sign In for Pricing
View Details