Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPTBN1 Rabbit Polyclonal Antibody (FITC)

SPTBN1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ELF, SPTB2, HEL102, betaSpII

UniProt

Q01082

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human SPTBN1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DKHEVSASTQSTPASSRAQTLPTSVVTITSESSPGKREKDKEKDKEKRFS

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003119.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dysferlin (DYSF) Rabbit Monoclonal Antibody
TA422567 100 µL

Dysferlin (DYSF) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
C20orf144 Human qPCR Primer Pair (NM_080825)
HP216758 200 Reactions

C20orf144 Human qPCR Primer Pair (NM_080825)

Sign In for Pricing
View Details
DAXX Human Gene Knockout Kit (CRISPR)
KN419497 1 Kit

DAXX Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), 0.2mg/mL
BNUB1859-500 1x 500 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), 0.2mg/mL

Sign In for Pricing
View Details
PSMD1 (NM_002807) Human Over-expression Lysate
LC400995 20 µg

PSMD1 (NM_002807) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS512063 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details