Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPTBN1 Rabbit Polyclonal Antibody (HRP)

SPTBN1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ELF, SPTB2, HEL102, betaSpII

UniProt

Q01082

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human SPTBN1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DKHEVSASTQSTPASSRAQTLPTSVVTITSESSPGKREKDKEKDKEKRFS

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003119.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NELF (NSMF) (NM_001130969) Human Over-expression Lysate
LC427331 20 µg

NELF (NSMF) (NM_001130969) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant MCM2 (phospho S27) Antibody
RC-16641-01 50 μL

Recombinant MCM2 (phospho S27) Antibody

Sign In for Pricing
View Details
Recombinant MCM2 (phospho S27) Antibody
RC-16641-02 100 µL

Recombinant MCM2 (phospho S27) Antibody

Sign In for Pricing
View Details
Recombinant MCM2 (phospho S27) Antibody
RC-16641-03 1 mL

Recombinant MCM2 (phospho S27) Antibody

Sign In for Pricing
View Details
Tuberin Recombinant Rabbit Monoclonal Antibody [SC05-59]
ET1610-10 100 µL

Tuberin Recombinant Rabbit Monoclonal Antibody [SC05-59]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Epidermal Growth Factor,  20nm
GM-42-20 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Epidermal Growth Factor, 20nm

Sign In for Pricing
View Details