Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPP21 Rabbit Polyclonal Antibody (HRP)

RPP21 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CAT60, C6orf135

UniProt

Q9BWT7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVPGLTCTQRQRRCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055365

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR26 Rabbit Polyclonal Antibody (PerCP)
orb1592463 100 µL

WDR26 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
KIAA0664 (CLUH) (NM_015229) Human Tagged ORF Clone
RG220737 10 µg

KIAA0664 (CLUH) (NM_015229) Human Tagged ORF Clone

Sign In for Pricing
View Details
CCDC115 Protein Vector (Mouse) (pPB-N-His)
PV162067 500 ng

CCDC115 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Anti-Hu CD21 Alexa Fluor® 647
A6-306-T025 25 Tests

Anti-Hu CD21 Alexa Fluor® 647

Sign In for Pricing
View Details
Tpte2 Rat siRNA Oligo Duplex (Locus ID 364629)
SR515002 1 Kit

Tpte2 Rat siRNA Oligo Duplex (Locus ID 364629)

Sign In for Pricing
View Details
Anti-AMHR2 Reference Antibody (murlentamab-MMAE)
E24CHB289 100 µg

Anti-AMHR2 Reference Antibody (murlentamab-MMAE)

Sign In for Pricing
View Details