Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPP21 Rabbit Polyclonal Antibody (HRP)

RPP21 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CAT60, C6orf135

UniProt

Q9BWT7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVPGLTCTQRQRRCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055365

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Arginase 1/ARG1/liver Arginase Antibody (ARG1/1125) [DyLight 405]
NBP2-47998V 0.1 mL

Mouse Monoclonal Arginase 1/ARG1/liver Arginase Antibody (ARG1/1125) [DyLight 405]

Sign In for Pricing
View Details
Mouse Monoclonal Actin Antibody (mAbGEa) - Azide and BSA Free
NBP2-80561 0.1 mL

Mouse Monoclonal Actin Antibody (mAbGEa) - Azide and BSA Free

Sign In for Pricing
View Details
PLVX-EnCMV-PER2 (human) -PGK-Puro
BZ40359 1 Vial

PLVX-EnCMV-PER2 (human) -PGK-Puro

Sign In for Pricing
View Details
Mouse Tyrosine-protein phosphatase non-receptor type 11 (PTPN11) ELISA Kit
MBS7227614-01 48 Well

Mouse Tyrosine-protein phosphatase non-receptor type 11 (PTPN11) ELISA Kit

Sign In for Pricing
View Details
Mouse Tyrosine-protein phosphatase non-receptor type 11 (PTPN11) ELISA Kit
MBS7227614-02 96 Well

Mouse Tyrosine-protein phosphatase non-receptor type 11 (PTPN11) ELISA Kit

Sign In for Pricing
View Details
Mouse Tyrosine-protein phosphatase non-receptor type 11 (PTPN11) ELISA Kit
MBS7227614-03 5x 96 Well

Mouse Tyrosine-protein phosphatase non-receptor type 11 (PTPN11) ELISA Kit

Sign In for Pricing
View Details