Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nup160 Rabbit Polyclonal Antibody (FITC)

Nup160 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Gtl13, 160kDa, Gtl-13, Gtl1-1, Gtl1-13, AA414952, AU020188, mKIAA0197, 2810011M03Rik

UniProt

Q9Z0W3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WLPYSSIDQLLQALGENSANSHNIILSQKILDKLEDYQQKVDKATRDLLY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

158kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_067487

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCTN6 Human Gene Knockout Kit (CRISPR)
KN401937 1 Kit

DCTN6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Artery: peripheral
CS630286 5x 5 µm

Frozen Tissue Sections, Artery: peripheral

Sign In for Pricing
View Details
Styrene-d8 (Stabilized with Hydroquinone)
TRC-S687793-1G 1 g

Styrene-d8 (Stabilized with Hydroquinone)

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD28 Antibody[CD28.2]
E-AB-F1195M-01 20 Tests

Elab Fluor® 647 Anti-Human CD28 Antibody[CD28.2]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD28 Antibody[CD28.2]
E-AB-F1195M-02 100 Tests

Elab Fluor® 647 Anti-Human CD28 Antibody[CD28.2]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD28 Antibody[CD28.2]
E-AB-F1195M-03 2x 100 Tests

Elab Fluor® 647 Anti-Human CD28 Antibody[CD28.2]

Sign In for Pricing
View Details