Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nup160 Rabbit Polyclonal Antibody (HRP)

Nup160 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gtl13, 160kDa, Gtl-13, Gtl1-1, Gtl1-13, AA414952, AU020188, mKIAA0197, 2810011M03Rik

UniProt

Q9Z0W3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WLPYSSIDQLLQALGENSANSHNIILSQKILDKLEDYQQKVDKATRDLLY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

158kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_067487

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Octyl Maleimide
TRC-O290025-5G 5 g

Octyl Maleimide

Sign In for Pricing
View Details
Human IL-12 (linked heterodimer), C-His Tag
HA210910-01 20 µg

Human IL-12 (linked heterodimer), C-His Tag

Sign In for Pricing
View Details
Human IL-12 (linked heterodimer), C-His Tag
HA210910-02 50 µg

Human IL-12 (linked heterodimer), C-His Tag

Sign In for Pricing
View Details
Human IL-12 (linked heterodimer), C-His Tag
HA210910-03 100 µg

Human IL-12 (linked heterodimer), C-His Tag

Sign In for Pricing
View Details
SLC12A4 (997-1007) Goat Polyclonal Antibody
AP08770PU-N 50 µg

SLC12A4 (997-1007) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Bricd5 Mouse Gene Knockout Kit (CRISPR)
KN502264 1 Kit

Bricd5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details