Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFGAP3 Rabbit Polyclonal Antibody (HRP)

ARFGAP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARFGAP1

UniProt

Q9NP61

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FHQHGCSTNDTNAKYNSRAAQLYREKIKSLASQATRKHGTDLWLDSCVVP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055385

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr678 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4270704 1.0 µg DNA

Olfr678 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Lentiviral mouse Med25 shRNA (UAS) - Lentiviral mouse Med25 shRNA (UAS, GFP) plasmid
GTR15136438 1 Vial

Lentiviral mouse Med25 shRNA (UAS) - Lentiviral mouse Med25 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
LRRK2 (Leucine-rich Repeat Kinase 2, Leucine-rich Repeat Serine/threonine Protein Kinase 2, AURA17, Dardarin, PARK8, RIPK7, ROCO2) (MaxLight 405) discontinued
L4502-20G-ML405 100 µL

LRRK2 (Leucine-rich Repeat Kinase 2, Leucine-rich Repeat Serine/threonine Protein Kinase 2, AURA17, Dardarin, PARK8, RIPK7, ROCO2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
EZ Cap™ Mouse RLI mRNA (m1Ψ)
R1075-5 5x 1 mg (1 mg/mL)

EZ Cap™ Mouse RLI mRNA (m1Ψ)

Sign In for Pricing
View Details
Eldelumab (CXCL10)
591815 100 µg

Eldelumab (CXCL10)

Sign In for Pricing
View Details
FBXL16 (NM_153350) Human Tagged Lenti ORF Clone
RC206362L1 10 µg

FBXL16 (NM_153350) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details