Recombinant Human Placenta growth factor (PGF) (Active)
Product Specifications
Product Name Alternative
Placenta growth factor; PlGF; PGF; PGFL, PLGF
Abbreviation
Recombinant Human PGF protein (Active)
Gene Name
PGF
UniProt
P49763-3
Expression Region
19-170aa
Organism
Homo sapiens (Human)
Target Sequence
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
Tag
C-terminal hFc1-tagged
Type
Active Protein & In Stock Protein
Source
Mammalian cell
Field of Research
Cardiovascular
Relevance
Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Yes
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human FLT1 (CSB-MP008732HU) protein at 2 μg/mL can bind Human PGF protein. The EC50 is 10.72-15.25 ng/mL.
Form
Lyophilized powder
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
45.1 kDa
References & Citations
HRG inhibits tumor growth and metastasis by inducing macrophage polarization and vessel normalization through downregulation of PlGF. Rolny C., Mazzone M., Tugues S., Laoui D., Johansson I., Coulon C., Squadrito M.L., Segura I., Li X., Carmeliet P. Cancer Cell 19:31-44 (2011)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein of Isoform PlGF-2
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E0539 1 Unit
Constant Temperature Water Bath; Water Bath; Thermostat Water Bath
Sign In for Pricing
View Details 
LS010003-100ug 100 µg
NAALAD2 (NM_005467) Human Over-expression Lysate
Sign In for Pricing
View Details orb1064726 100 µL
Density Regulated Protein Rabbit Polyclonal Antibody (Cy7)
Sign In for Pricing
View Details 
GTR15124613 1 Vial
Lentiviral human SIGLEC11 shRNA (UAS) - Lentiviral human SIGLEC11 shRNA (UAS) (25)
Sign In for Pricing
View Details LV813398 1.0 µg DNA
NAT11 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
Sign In for Pricing
View Details