Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Placenta growth factor (PGF) (Active)

Product Specifications

Product Name Alternative

Placenta growth factor; PlGF; PGF; PGFL, PLGF

Abbreviation

Recombinant Human PGF protein (Active)

Gene Name

PGF

UniProt

P49763-3

Expression Region

19-170aa

Organism

Homo sapiens (Human)

Target Sequence

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Tag

C-terminal hFc1-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cardiovascular

Relevance

Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human FLT1 (CSB-MP008732HU) protein at 2 μg/mL can bind Human PGF protein. The EC50 is 10.72-15.25 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

45.1 kDa

References & Citations

HRG inhibits tumor growth and metastasis by inducing macrophage polarization and vessel normalization through downregulation of PlGF. Rolny C., Mazzone M., Tugues S., Laoui D., Johansson I., Coulon C., Squadrito M.L., Segura I., Li X., Carmeliet P. Cancer Cell 19:31-44 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein of Isoform PlGF-2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat RAC-beta serine/threonine-protein kinase, Akt2 ELISA Kit
MBS1611702-01 48 Well

Rat RAC-beta serine/threonine-protein kinase, Akt2 ELISA Kit

Sign In for Pricing
View Details
Rat RAC-beta serine/threonine-protein kinase, Akt2 ELISA Kit
MBS1611702-02 96 Well

Rat RAC-beta serine/threonine-protein kinase, Akt2 ELISA Kit

Sign In for Pricing
View Details
Rat RAC-beta serine/threonine-protein kinase, Akt2 ELISA Kit
MBS1611702-03 5x 96 Well

Rat RAC-beta serine/threonine-protein kinase, Akt2 ELISA Kit

Sign In for Pricing
View Details
Rat RAC-beta serine/threonine-protein kinase, Akt2 ELISA Kit
MBS1611702-04 10x 96 Well

Rat RAC-beta serine/threonine-protein kinase, Akt2 ELISA Kit

Sign In for Pricing
View Details
ATP6V1B2 Protein Vector (Human) (pPB-His-MBP)
PV325458 500 ng

ATP6V1B2 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Abacavir sulfate - Bio-X TM
BA165908 10 mg

Abacavir sulfate - Bio-X TM

Sign In for Pricing
View Details