Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSRB3 Rabbit Polyclonal Antibody (FITC)

MSRB3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DFNB74

UniProt

Q8IXL7

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence ESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEA

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEA

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC

NCBI Accession Number

NP_932346

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CUE domain-containing Protein 2
312334-01 50 µg

CUE domain-containing Protein 2

Sign In for Pricing
View Details
CUE domain-containing Protein 2
312334-02 100 µg

CUE domain-containing Protein 2

Sign In for Pricing
View Details
P5F1B, CT (POU5F1B, OTF3C, OTF3P1, POU5F1P1, POU5FLC20, POU5FLC8, Putative POU domain, class 5, transcription factor 1B, Octamer-binding protein 3-like, Octamer-binding transcription factor 3-like)
039595 200 µL

P5F1B, CT (POU5F1B, OTF3C, OTF3P1, POU5F1P1, POU5FLC20, POU5FLC8, Putative POU domain, class 5, transcription factor 1B, Octamer-binding protein 3-like, Octamer-binding transcription factor 3-like)

Sign In for Pricing
View Details
Anti-ABCC10 Polyclonal Antibody
PTX26809-01 50 µg

Anti-ABCC10 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-ABCC10 Polyclonal Antibody
PTX26809-02 100 µg

Anti-ABCC10 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-ABCC10 Polyclonal Antibody
PTX26809-03 1 mg

Anti-ABCC10 Polyclonal Antibody

Sign In for Pricing
View Details