Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKN2 Rabbit Polyclonal Antibody (Biotin)

PKN2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PAK2, PRK2, STK7, Pak-2, PRKCL2, PRO2042

UniProt

Q16513

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

108kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_006247

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

pLV3-CMV-IFI27-CopGFP-Puro Plasmid
PVT57248 2 µg

pLV3-CMV-IFI27-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 Purine nucleoside phosphorylase DeoD-type (deoD)
MBS1021639-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O17:K52:H18 Purine nucleoside phosphorylase DeoD-type (deoD)

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 Purine nucleoside phosphorylase DeoD-type (deoD)
MBS1021639-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O17:K52:H18 Purine nucleoside phosphorylase DeoD-type (deoD)

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 Purine nucleoside phosphorylase DeoD-type (deoD)
MBS1021639-03 0.02 mg (Yeast)

Recombinant Escherichia coli O17:K52:H18 Purine nucleoside phosphorylase DeoD-type (deoD)

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 Purine nucleoside phosphorylase DeoD-type (deoD)
MBS1021639-04 0.1 mg (Yeast)

Recombinant Escherichia coli O17:K52:H18 Purine nucleoside phosphorylase DeoD-type (deoD)

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 Purine nucleoside phosphorylase DeoD-type (deoD)
MBS1021639-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O17:K52:H18 Purine nucleoside phosphorylase DeoD-type (deoD)

Sign In for Pricing
View Details