Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKN2 Rabbit Polyclonal Antibody (HRP)

PKN2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PAK2, PRK2, STK7, Pak-2, PRKCL2, PRO2042

UniProt

Q16513

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

108kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_006247

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

REEP3 Rabbit Polyclonal Antibody
orb1728088 100 µg

REEP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Surge Safety Boot Size 3 - PR
SAF3067 PR

Surge Safety Boot Size 3 - PR

Sign In for Pricing
View Details
KCND3 Antibody
A73470-100UL 100 µL

KCND3 Antibody

Sign In for Pricing
View Details
PBX4 (Pre-B Cell Leukemia Transcription Factor 4, Homeobox Protein PBX4) (HRP)
130923-HRP 100 µL

PBX4 (Pre-B Cell Leukemia Transcription Factor 4, Homeobox Protein PBX4) (HRP)

Sign In for Pricing
View Details
Lentiviral mouse Wdr54 shRNA (UAS) - Lentiviral mouse Wdr54 shRNA (UAS, RFP) (25)
GTR15276851 1 Vial

Lentiviral mouse Wdr54 shRNA (UAS) - Lentiviral mouse Wdr54 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Mmu-miR-185-3p miRNA Agomir
orb1918123-01 5 nmol

Mmu-miR-185-3p miRNA Agomir

Sign In for Pricing
View Details