Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKN2 Rabbit Polyclonal Antibody (HRP)

PKN2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PAK2, PRK2, STK7, Pak-2, PRKCL2, PRO2042

UniProt

Q16513

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

108kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_006247

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Shigella flexneri rpsS Polyclonal Antibody
MBS7165166 Inquire

Rabbit anti-Shigella flexneri rpsS Polyclonal Antibody

Sign In for Pricing
View Details
Glutathione ELISA Kit
ECP7869 1 Each

Glutathione ELISA Kit

Sign In for Pricing
View Details
Phospho-PIN1 (Ser16) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-25158R-BF680 100 µL

Phospho-PIN1 (Ser16) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
HSPH1 Antibody
OACA06785-50UL 50 µL

HSPH1 Antibody

Sign In for Pricing
View Details
Tmem104 siRNA Oligos set (Rat)
46857176 3x 5 nmol

Tmem104 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Ac-Beta-Amyloid-Protein (15-20) amide
MBS8223594-01 1 mg

Ac-Beta-Amyloid-Protein (15-20) amide

Sign In for Pricing
View Details