Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pkn2 Rabbit Polyclonal Antibody (Biotin)

Pkn2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PR, Prk, Stk, PRK2, Stk7, Prkcl2, AI507382, 6030436C20Rik

UniProt

Q8BWW9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Pkn2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LRRNPERRLGAGEKDAEDVKKHPFFRLTDWSALMDKKVKPPFVPTIRGRE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

111kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_848769

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC33 (NM_012382) Human Over-expression Lysate
LS023548-20ug 20 µg

TTC33 (NM_012382) Human Over-expression Lysate

Sign In for Pricing
View Details
Ifi47 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7259502 1.0 µg DNA

Ifi47 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
APOLD1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
12202151 3x 1.0 µg DNA

APOLD1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Mouse Map2k5 Rabbit Polyclonal Antibody
E10G31407 100 µL

Mouse Map2k5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HNF1A-AS1 Human shRNA Plasmid Kit (Locus ID 283460)
TL318219 1 Kit

HNF1A-AS1 Human shRNA Plasmid Kit (Locus ID 283460)

Sign In for Pricing
View Details
pCMV-HMGCS2-3×HA-Neo Plasmid
PVT60660 2 µg

pCMV-HMGCS2-3×HA-Neo Plasmid

Sign In for Pricing
View Details