Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBL1XR1 Rabbit Polyclonal Antibody (Biotin)

TBL1XR1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C21, DC42, IRA1, MRD41, TBLR1

UniProt

Q9BZK7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SGSFDKCVHIWNTQTGALVHSYRGTGGIFEVCWNAAGDKVGASASDGSVC

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078941

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D1]
TA802226BM 100 µL

CD4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D1]

Sign In for Pricing
View Details
Adiponectin (ADIPOQ) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E12]
TA804576AM 100 µL

Adiponectin (ADIPOQ) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E12]

Sign In for Pricing
View Details
p-Butyl Ibuprofen
TRC-B626305-1MG 1 mg

p-Butyl Ibuprofen

Sign In for Pricing
View Details
Borcs7 (NM_025563) Mouse Tagged ORF Clone
MG200354 10 µg

Borcs7 (NM_025563) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CUG-BP1 Recombinant Rabbit Monoclonal Antibody [JE40-85]
HA722552 100 µL

CUG-BP1 Recombinant Rabbit Monoclonal Antibody [JE40-85]

Sign In for Pricing
View Details
CD86 (Dendritic Cells Maturation Marker) (rC86/1146), 1mg/mL
BNUM2083-50 1x 50 µL

CD86 (Dendritic Cells Maturation Marker) (rC86/1146), 1mg/mL

Sign In for Pricing
View Details