Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBL1XR1 Rabbit Polyclonal Antibody (FITC)

TBL1XR1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C21, DC42, IRA1, MRD41, TBLR1

UniProt

Q9BZK7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SGSFDKCVHIWNTQTGALVHSYRGTGGIFEVCWNAAGDKVGASASDGSVC

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078941

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cpb1 activation kit by CRISPRa
GA210584 1 Kit

Mouse Cpb1 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human Kelch-like ECH-associated protein 1 (KEAP1), Biotinylated
MBS9021563-01 0.02 mg (E-Coli)

Recombinant Human Kelch-like ECH-associated protein 1 (KEAP1), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Kelch-like ECH-associated protein 1 (KEAP1), Biotinylated
MBS9021563-02 0.1 mg (E-Coli)

Recombinant Human Kelch-like ECH-associated protein 1 (KEAP1), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Kelch-like ECH-associated protein 1 (KEAP1), Biotinylated
MBS9021563-03 1 mg (E-Coli)

Recombinant Human Kelch-like ECH-associated protein 1 (KEAP1), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Kelch-like ECH-associated protein 1 (KEAP1), Biotinylated
MBS9021563-04 5x 1 mg (E-Coli)

Recombinant Human Kelch-like ECH-associated protein 1 (KEAP1), Biotinylated

Sign In for Pricing
View Details
Melanopsin (Melanopsin, Opsin-4, OPN4, MOP) discontinued
224153-01 50 µL

Melanopsin (Melanopsin, Opsin-4, OPN4, MOP) discontinued

Sign In for Pricing
View Details