Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP2U1 Rabbit Polyclonal Antibody (HRP)

CYP2U1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SPG49, SPG56, P450TEC

UniProt

Q7Z449

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VNICPWLYYLPFGPFKELRQIEKDITSFLKKIIKDHQESLDRENPQDFID

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_898898

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Acetyl-coenzyme A synthetase, cytoplasmic (ACSS2) ELISA Kit
MBS7234083-01 48 Well

Rat Acetyl-coenzyme A synthetase, cytoplasmic (ACSS2) ELISA Kit

Sign In for Pricing
View Details
Rat Acetyl-coenzyme A synthetase, cytoplasmic (ACSS2) ELISA Kit
MBS7234083-02 96 Well

Rat Acetyl-coenzyme A synthetase, cytoplasmic (ACSS2) ELISA Kit

Sign In for Pricing
View Details
Rat Acetyl-coenzyme A synthetase, cytoplasmic (ACSS2) ELISA Kit
MBS7234083-03 5x 96 Well

Rat Acetyl-coenzyme A synthetase, cytoplasmic (ACSS2) ELISA Kit

Sign In for Pricing
View Details
Rat Acetyl-coenzyme A synthetase, cytoplasmic (ACSS2) ELISA Kit
MBS7234083-04 10x 96 Well

Rat Acetyl-coenzyme A synthetase, cytoplasmic (ACSS2) ELISA Kit

Sign In for Pricing
View Details
(-) -Galanthaminyl (-) -Camphanate
sc-218561 1 mg

(-) -Galanthaminyl (-) -Camphanate

Sign In for Pricing
View Details
RNY1P1 Protein Vector (Human) (pPM-C-HA)
40608021 500 ng

RNY1P1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details