Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP2U1 Rabbit Polyclonal Antibody (HRP)

CYP2U1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SPG49, SPG56, P450TEC

UniProt

Q7Z449

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VNICPWLYYLPFGPFKELRQIEKDITSFLKKIIKDHQESLDRENPQDFID

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_898898

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX3Y (N-term) Rabbit Polyclonal Antibody
AP51221PU-N 400 µL

DDX3Y (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ephrin-B2/EFNB2 hFc Chimera, Human
Z05259-500 500 µg

Ephrin-B2/EFNB2 hFc Chimera, Human

Sign In for Pricing
View Details
Mouse Monoclonal Adenosine A2aR Antibody (599717) [Alexa Fluor 488]
FAB9497G 0.1 mL

Mouse Monoclonal Adenosine A2aR Antibody (599717) [Alexa Fluor 488]

Sign In for Pricing
View Details
GDNF (Glial Cell Line Derived Neurotrophic Factor) BioAssayTM ELISA Kit (Human) discontinued
383057 96 Tests

GDNF (Glial Cell Line Derived Neurotrophic Factor) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
ABCC8 Rabbit pAb (APR28243N)
APR28243N-01 50 µL

ABCC8 Rabbit pAb (APR28243N)

Sign In for Pricing
View Details
ABCC8 Rabbit pAb (APR28243N)
APR28243N-02 100 µL

ABCC8 Rabbit pAb (APR28243N)

Sign In for Pricing
View Details