Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccdc6 Rabbit Polyclonal Antibody (FITC)

Ccdc6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AA536681, AA960498, AW061011, 2810012H18Rik

UniProt

D3YZP9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001104591

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3497), CF594 conjugate, 0.1mg/mL
BNC943497-500 1x 500 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3497), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phospho-IGF1 Receptor (Tyr1165/Tyr1166) Rabbit pAb, 1 pack = 50 µL
BAL2757 1 Each

Phospho-IGF1 Receptor (Tyr1165/Tyr1166) Rabbit pAb, 1 pack = 50 µL

Sign In for Pricing
View Details
TDO2 Rabbit Polyclonal Antibody (FITC)
orb2991606 100 µg

TDO2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
KRT4 (Cytokeratin 4, Keratin 4, K4, CK4, CK-4, CYK4) (MaxLight 405)
MBS6424257-01 0.1 mL

KRT4 (Cytokeratin 4, Keratin 4, K4, CK4, CK-4, CYK4) (MaxLight 405)

Sign In for Pricing
View Details
KRT4 (Cytokeratin 4, Keratin 4, K4, CK4, CK-4, CYK4) (MaxLight 405)
MBS6424257-02 5x 0.1 mL

KRT4 (Cytokeratin 4, Keratin 4, K4, CK4, CK-4, CYK4) (MaxLight 405)

Sign In for Pricing
View Details
Rabbit LIM/homeobox protein Lhx5 (LHX5) ELISA Kit
MBS7208944-01 48 Well

Rabbit LIM/homeobox protein Lhx5 (LHX5) ELISA Kit

Sign In for Pricing
View Details