Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccdc6 Rabbit Polyclonal Antibody (HRP)

Ccdc6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AA536681, AA960498, AW061011, 2810012H18Rik

UniProt

D3YZP9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001104591

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC14 Protein Vector (Mouse) (pPB-C-His)
PV197542 500 ng

LRRC14 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Anti-HAO1 Antibody Picoband® (Biotine Conjugate)
A09159-2-Biotin 100 µg/Vial

Anti-HAO1 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
Recombinant Escherichia coli Heat shock protein hspQ (hspQ)
MBS1069457-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Heat shock protein hspQ (hspQ)

Sign In for Pricing
View Details
Recombinant Escherichia coli Heat shock protein hspQ (hspQ)
MBS1069457-02 0.1 mg (E-Coli)

Recombinant Escherichia coli Heat shock protein hspQ (hspQ)

Sign In for Pricing
View Details
Recombinant Escherichia coli Heat shock protein hspQ (hspQ)
MBS1069457-03 0.02 mg (Yeast)

Recombinant Escherichia coli Heat shock protein hspQ (hspQ)

Sign In for Pricing
View Details
Recombinant Escherichia coli Heat shock protein hspQ (hspQ)
MBS1069457-04 0.1 mg (Yeast)

Recombinant Escherichia coli Heat shock protein hspQ (hspQ)

Sign In for Pricing
View Details