Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CKAP2 Rabbit Polyclonal Antibody (HRP)

CKAP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LB1, TMAP, se20-10

UniProt

Q8WWK9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GKAIVDSRSAQPKETSEERKARLSEWKAGKGRVLKRPPNSVVTQHEPAGQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001091995

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSI-6206-13C, d3
HY-15236S 1 mg

PSI-6206-13C, d3

Sign In for Pricing
View Details
GALNS (N-acetylgalactosamine-6-sulfatase, Chondroitinsulfatase, Chondroitinase, Galactose-6-sulfate Sulfatase, N-acetylgalactosamine-6-sulfate Sulfatase, GalNAc6S Sulfatase) (PE)
127127-PE 100 µL

GALNS (N-acetylgalactosamine-6-sulfatase, Chondroitinsulfatase, Chondroitinase, Galactose-6-sulfate Sulfatase, N-acetylgalactosamine-6-sulfate Sulfatase, GalNAc6S Sulfatase) (PE)

Sign In for Pricing
View Details
Recombinant Bovine coronavirus Protein I (N)
orb1096632-01 20 µg

Recombinant Bovine coronavirus Protein I (N)

Sign In for Pricing
View Details
Recombinant Bovine coronavirus Protein I (N)
orb1096632-02 100 µg

Recombinant Bovine coronavirus Protein I (N)

Sign In for Pricing
View Details
Recombinant Bovine coronavirus Protein I (N)
orb1096632-03 1 mg

Recombinant Bovine coronavirus Protein I (N)

Sign In for Pricing
View Details
Human Uncharacterized protein C2orf57 (TEX44) ELISA Kit
abx504926 96 Tests

Human Uncharacterized protein C2orf57 (TEX44) ELISA Kit

Sign In for Pricing
View Details