Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CKAP2 Rabbit Polyclonal Antibody (HRP)

CKAP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LB1, TMAP, se20-10

UniProt

Q8WWK9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GKAIVDSRSAQPKETSEERKARLSEWKAGKGRVLKRPPNSVVTQHEPAGQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001091995

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFITM1 Polyclonal Antibody
A70751-050 50 µL

IFITM1 Polyclonal Antibody

Sign In for Pricing
View Details
TRAF1 (TNF Receptor-associated Factor 1, Epstein-Barr Virus-induced Protein 6, EBI6) (APC)
134666-APC 100 µL

TRAF1 (TNF Receptor-associated Factor 1, Epstein-Barr Virus-induced Protein 6, EBI6) (APC)

Sign In for Pricing
View Details
Human Amyloid Precursor Protein APP ELISA Kit
orb1176666 1x 96 Tests

Human Amyloid Precursor Protein APP ELISA Kit

Sign In for Pricing
View Details
GIMAP6 Polyclonal Antibody, FITC Conjugated
bs-8272R-FITC 100 µL

GIMAP6 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Human VPS13C qPCR Primer Pair
QH43193S 200 Tests

Human VPS13C qPCR Primer Pair

Sign In for Pricing
View Details
ITGA10 Human Pre-designed siRNA Set A
HY-RS06946 1 Set

ITGA10 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details