Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL23A Rabbit Polyclonal Antibody (FITC)

RPL23A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L23A, MDA20

UniProt

P62750

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000975

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Mitochondrial ribonuclease P protein 1, RG9MTD1 ELISA KIT
ELI-46315h 96 Tests

Human Mitochondrial ribonuclease P protein 1, RG9MTD1 ELISA KIT

Sign In for Pricing
View Details
KLK8 Polyclonal Antibody, HRP Conjugated
bs-5871R-HRP-TR 20 µL

KLK8 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Human HER3 (544-643) Protein, mFc Tag
32-18391-100 100 µg

Human HER3 (544-643) Protein, mFc Tag

Sign In for Pricing
View Details
Eomes sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
19332114 3x 1.0 µg

Eomes sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
ACVRL1 Rabbit Polyclonal Antibody
orb624485-01 50 µg

ACVRL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACVRL1 Rabbit Polyclonal Antibody
orb624485-02 100 µg

ACVRL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details