Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL23A Rabbit Polyclonal Antibody (HRP)

RPL23A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L23A, MDA20

UniProt

O75818

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006629

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGEF4 (143-271) Mouse Monoclonal Antibody [Clone ID: ARHGEF-08]
AM26710PU-N 100 µg

ARHGEF4 (143-271) Mouse Monoclonal Antibody [Clone ID: ARHGEF-08]

Sign In for Pricing
View Details
DYNLL1 Recombinant Rabbit Monoclonal Antibody [SD08-04]
ET1612-64 100 µL

DYNLL1 Recombinant Rabbit Monoclonal Antibody [SD08-04]

Sign In for Pricing
View Details
Rpl22 Mouse Gene Knockout Kit (CRISPR)
KN515025 1 Kit

Rpl22 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
15-Acetyl Deoxynivalenol (~90%)
TRC-A173515-1MG 1 mg

15-Acetyl Deoxynivalenol (~90%)

Sign In for Pricing
View Details
PE Conjugated Anti-Mouse CD4 Recombinant Antibody [PSH04-99] - Rabbit IgG (Chimeric)
HA720203F 100 µL

PE Conjugated Anti-Mouse CD4 Recombinant Antibody [PSH04-99] - Rabbit IgG (Chimeric)

Sign In for Pricing
View Details
Human TAS2R46 activation kit by CRISPRa
GA116922 1 Kit

Human TAS2R46 activation kit by CRISPRa

Sign In for Pricing
View Details